Ab Biotechnology Products
We have a range of polyclonal rabbit antibodies produced under GMP for use in R&D. The polyclonals are highly specific as they are purified using an affinity column against the specific target as opposed to non-specific protein A purification. Purity greater than 95%, with activity against target confirmed by ELISA. The antibodies are stable for 5 years at -80C. We have accelerated, long term, freeze/thaw and photostability data for the products. The product will be supplied with Quality Assured Certificate of Analysis and Certificate of Origin.
| Product | Immunogen | Unit Cost/Per 100 µL | Unit Cost /Per 500 µL |
|---|---|---|---|
| Rabbit Polyclonal Antibodies to IFN-Gamma | Recombinant IFN-Gamma | £325 | £1105 |
| Rabbit Polyclonal Antibodies to Histamine | Histamine-KLH | £286 | £988 |
| Rabbit Polyclonal Antibodies to Bradykinin | Bradykinin acetate-Ovalbumin | £403 | £1339 |
| Rabbit Polyclonal Antibodies to Morphine | Morphine-6-Hemmisuccinate-Ovalbumin | £455 | £1495 |
| Rabbit Polyclonal Antibodies to PSA | Peptide-KLH (SRIVGGWECEKHSQP) | £325 | £1105 |
| Rabbit Polyclonal Antibodies to CD4 | CD4 peptide (IGLGIFFCVRCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI) | £390 | £1300 |
| Rabbit Polyclonal Antibodies to HLA | HLA peptide (GDTRPRFLWQLKFECHFFNGTERVRLLER) | £455 | £1495 |
| Rabbit Polyclonal Antibodies to Beta-2-Microglobulin | Recombinant Beta-2-Microglobulin | £325 | £1105 |
| Rabbit Polyclonal Antibodies to Insulin Receptor | Peptide-KLH (GGKKNGRILTLPRSNPS) | £325 | £1105 |
| Rabbit Polyclonal Antibodies to NO Synthase | Peptide-KLH (RHLRGAVPWAFDPPGPDTPGP) | £325 | £1105 |
| Rabbit Polyclonal Antibodies to S100 | Native source protein | £520 | £1690 |
All materials will be shipped at 2-8°C, costs to be determined at time of sale.
For sales please contact us