Rabbit Polyclonal Antibodies to CD4
| Catalog | ABB-010 |
|---|---|
| Product Name | Rabbit polyclonal antibodies to CD4 |
| Applications | ELISA, Western Blot |
| Reactivity | Human (may cross-react with other species) |
| SPECIFICATIONS | |
| Conjugation | Unconjugated |
| Host | Rabbit |
| Immunogen | Peptide (IGLGIFFCVRCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI from P01730) |
| Clonality | Polyclonal |
| Isotype | IgG/IgM |
| Concentration | Batch dependent within range 2.0-2.5 mg/mL |
| Purification | Immunogen affinity purified |
| Buffer | Glycine pH 7.2 |
| Shipment | 2-8°C |
| Storage Conditions | Short term up to 1 month at 2-8°C, long term can be held for up to five years at -70 °C. Although repeated freeze/thaw is not advised, no adverse effects have been observed with up to 3 Freeze/Thaw cycles. |
| Size | 100 µL (liquid) and 500 µL (liquid) |
Rabbit Polyclonal Antibodies to CD4, Cat No ABB-010
Western blot demonstrating our polyclonal detecting recombinant human CD4 (P01730) at 1in2000 dilution
| Lane | Sample |
|---|---|
| 1 | Marker |
| 2 | CD4 (1ng) |
| 3 | CD4 (5ng) |
| 4 | CD4 (10ng) |
| 5 | CD4 (50ng) |
ELISA Plates were coated with 1 µg/mL recombinant human CD4 protein, our polyclonal anti-CD4 was added at different concentrations and detected with an anti-rabbit HRP.
